DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp-3

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_502044.1 Gene:aqp-3 / 190553 WormBaseID:WBGene00000171 Length:421 Species:Caenorhabditis elegans


Alignment Length:251 Identity:71/251 - (28%)
Similarity:106/251 - (42%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGSTTSGSVPQ--------IAFTFGLTVATIAQGLG-HLSGCHINPAV 79
            |..|.||..|.||:|.|........:.|        |:..:|| |..:|..:| .:||.|:||||
 Worm   121 RAFLAELFCTGFLVFGGECVNAQYVLSQGKNNEWIGISVGWGL-VLMLAVLMGSKISGAHLNPAV 184

  Fly    80 TLGFLIVGEISILKAAFYIIVQCVGAIAGA-AVIKVALDGV---AGGDLGV-------SSF---- 129
            :...|..|:|::::...|.:.|.:||..|| .|..|..|.:   .||:..|       |.|    
 Worm   185 SFFQLTQGKINLIRFLVYAVAQNIGAFLGAFGVFCVYYDAINVFEGGNRTVTGPTATASIFATYP 249

  Fly   130 DPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKG----------SAPLAVGLAIAAGHLCAI 184
            .|.|....|::.:...|.:|...|.|::| .|..|..          .|.|.:.||:.||:    
 Worm   250 GPFLGTFNAIVDQIAGTLVLCLGVAAITD-RRNGIPAFLQPAWIGALLAFLGMSLALNAGY---- 309

  Fly   185 KLSGASMNPARSFGPAV----------VQGVWTYHWVYWVG---PIAGGLLAGIIY 227
                 ::||||.|.|.:          |.....|.| :|:.   |:.||:|...:|
 Worm   310 -----AINPARDFAPRLFNLCAGYGWEVFSYRNYKW-FWIPIICPMIGGVLGAWLY 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 70/249 (28%)
aqp-3NP_502044.1 MIP 121..362 CDD:238204 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.