DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp-5

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_505691.2 Gene:aqp-5 / 183221 WormBaseID:WBGene00000173 Length:316 Species:Caenorhabditis elegans


Alignment Length:266 Identity:61/266 - (22%)
Similarity:103/266 - (38%) Gaps:71/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELVGTFFLIFVGVGSTTSGSVPQIAFTFGLTVATIAQGL---------GHLSGCHINPAVTLGFL 84
            |.:|||..||.|   |...:|..|:...|||.|.:..||         |.:||.|.||.|:...:
 Worm    49 EFLGTFIFIFSG---TMQANVYDISQPVGLTHAALTHGLATIVVIAVFGKISGGHFNPVVSWAMV 110

  Fly    85 IVGEISILKAAFYIIVQCVGAIAG---------------------------AAVIKVALDGVAGG 122
            :..::...:..||:..|..|..||                           .|.|:...|.|...
 Worm   111 LCQKLHPFELPFYMFSQFFGGFAGNLLSACLQRKRDFLNWEDYSSIRYPLPTASIEYGYDKVHNS 175

  Fly   123 DL---------------GVSSFDPSLNCAQAVLIEALIT--FILVFVVKAVSDPGRQDIKGSAPL 170
            .|               |::....:....:.::.|.:.|  |:.|.::..|::...:    :.|.
 Worm   176 TLEKTILLTTQLAATTSGITHLGENHEWWEGLISETITTYFFVTVILMNVVNNEPSE----ATPF 236

  Fly   171 AVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGV-----------WTYHWVYWVGPIAGGLLAG 224
            .:|:.:.........::|.:|||.|:..|.:|..:           ||||::||.||..|..:|.
 Worm   237 IIGMMVIVNIFATASITGTAMNPVRALSPNIVGEIVLSSSSLPPNFWTYHYIYWAGPYLGSTIAV 301

  Fly   225 IIYRLI 230
            |.::|:
 Worm   302 IGFKLL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 60/261 (23%)
aqp-5NP_505691.2 MIP 45..307 CDD:294134 60/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3275
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm4734
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.