DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp-8

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001359963.1 Gene:aqp-8 / 180744 WormBaseID:WBGene00000176 Length:330 Species:Caenorhabditis elegans


Alignment Length:258 Identity:78/258 - (30%)
Similarity:115/258 - (44%) Gaps:38/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VADI--TENKKIWRMLLGELVGTFFLIFVGVGSTTSGSVPQIAFTFGLTVATIAQGLGHL----- 70
            ||.|  .|:::..|.||.|.:|||||:.:|..:....:|   |.....|...||.|:|.:     
 Worm     8 VASILRIEDQQFTRELLAECIGTFFLLLIGNAANIQAAV---AVGGNSTSCHIAWGIGFMFAVYL 69

  Fly    71 ----SGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVA-------LDG----VA 120
                ||.|:|||:::...|:|.:...|...|.|.|.:||..||||....       |||    |.
 Worm    70 AASVSGGHLNPAISVAQSILGNLPPWKIIPYAIAQVIGAFLGAAVAYFGHHDDLWKLDGGIRQVT 134

  Fly   121 GGDLGV---SSFDPSLNCAQAVLIEALI-TFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHL 181
            ||....   ::|.|........|::.:| |.:|..:|..::|...|...|..|:..|..::...:
 Worm   135 GGQATAGLFTTFPPDHMSVWGSLLDQIIGTAMLSGLVCLITDKRHQIPTGVVPVLAGSIMSMVAM 199

  Fly   182 CAIKLSGASMNPARSFGPAVVQGVWTYHW--------VYWVGPIAGGLLAGIIYRLIFKLKKG 236
            ......|.::||||.|||.|......|.|        .:|: ||.|.|:..||...|:|:..|
 Worm   200 TFGANGGFAINPARDFGPRVFCLCAGYGWEVFSAHGYYFWI-PIVGALIGSIIGAWIYKIFVG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 70/235 (30%)
aqp-8NP_001359963.1 MIP 21..261 CDD:350945 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.