DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp-7

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001379301.1 Gene:aqp-7 / 180589 WormBaseID:WBGene00000175 Length:302 Species:Caenorhabditis elegans


Alignment Length:263 Identity:75/263 - (28%)
Similarity:112/263 - (42%) Gaps:45/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VEKTEMSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVG--------STTSGSVPQIAFTFGL 58
            :|:||..:    |.|.....:.|..|.|..|||.|:|:|:|        :....:...|...:||
 Worm    16 LERTEQVR----AKIQIKNPLLRNALSEFFGTFLLLFIGIGIVMQFILSNEKLNTWININLGWGL 76

  Fly    59 TVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAV---------IKV 114
            .:|.........||.|.||||::.||.:|::.......|.:||.:||..|:|.         :|.
 Worm    77 AIAFTVYTCSKTSGGHFNPAVSIAFLTLGKLPFKDFLVYCVVQTIGAALGSAAAFGLYYDQFVKF 141

  Fly   115 ALDGVAGGDLGVSSFD------PSLNCAQ--AVLIEALITFILVFVVKAVSDPGRQDIKGSA-PL 170
            |  |.....||..:..      |:|:.:.  |...:...|.:||..|..|.|. |..|.|:| ||
 Worm   142 A--GAYRTILGPKATAGCFCSYPALHVSNTTAFFDQFAGTALLVLFVCVVIDK-RNGIPGAAHPL 203

  Fly   171 AVGLAI-AAGHLCAIKLSGASMNPARSFGPAVV------QGVWTYH----WVYWVGPIAGGLLAG 224
            ..||.: ..|....:.| |..:||||..||.:.      .||::||    |:..:.|:.|.:...
 Worm   204 LFGLVVMMIGTAYGMNL-GYPINPARDLGPRLFSFFIYGSGVFSYHSYYFWIPVIAPLFGAIFGA 267

  Fly   225 IIY 227
            ..|
 Worm   268 WSY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 69/240 (29%)
aqp-7NP_001379301.1 MIP 34..273 CDD:238204 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.