DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp-2

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001379056.1 Gene:aqp-2 / 174467 WormBaseID:WBGene00000170 Length:290 Species:Caenorhabditis elegans


Alignment Length:249 Identity:70/249 - (28%)
Similarity:106/249 - (42%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKIWRMLLGELVGTFFLIFVGVGSTTSGSVPQ--------------IAFTFGLTVATIAQGLGHL 70
            |::.|.:|.|..||:.|..:|:.......:|:              ||..||:.|:      ..|
 Worm    14 KELLRAVLAEFTGTYLLCLIGLSVVAQKVLPRPEVNEFIGVNVGFGIAIVFGVAVS------AKL 72

  Fly    71 SGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAA-VIKVALDGVAGGDLGVSSFD---- 130
            ||.||||||:..||.||:|:|::...|.:.|..||..||| |..|..|.:...|.||.:..    
 Worm    73 SGGHINPAVSFAFLSVGQITIVQFIAYFVAQFFGAFFGAATVYAVYNDAINVFDGGVRTVGGPKD 137

  Fly   131 ----------PSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVG---LAIAA--GH 180
                      |.|......:.:.:.|.:.||::..:.|..........|:.||   :||.|  |:
 Worm   138 TAGIFASYPAPHLGLVNGFVDQFVATAVFVFLIAHIVDKRNSYPTWLQPILVGTGFVAIGAAFGY 202

  Fly   181 LCAIKLSGASMNPARSFGPAVVQGVW-------TYHWVYWVGPIAGGLLAGIIY 227
            .|     |..:||||.|.|.:...::       .:.||..|||..|.::...:|
 Worm   203 NC-----GYPVNPARDFAPRLFTSIFYGGAVFTKWFWVPIVGPFVGAVVGIWLY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 68/244 (28%)
aqp-2NP_001379056.1 MIP 18..254 CDD:238204 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.