DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp7

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001365567.1 Gene:Aqp7 / 11832 MGIID:1314647 Length:316 Species:Mus musculus


Alignment Length:203 Identity:54/203 - (26%)
Similarity:92/203 - (45%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKIWRMLLGELVGTFFLIFVGVGST-------TSGSVPQIAFTFGLTVATIAQGLGHLSGCHINP 77
            |.:.|..|.|.:.|:.::..|:||.       .|||...:...||..|.......|.:||.|:|.
Mouse    16 KNMVREFLAEFLSTYVMMVFGLGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISGAHMNA 80

  Fly    78 AVTLGFLIVGEISILKAAFYIIVQCVGAIAGAA----VIKVALDGVAGGDLGVSSFDPSLNCA-- 136
            |||.....:|.::..|...|::.|.:|:.:.||    :...|::..|||||.|:....:.|..  
Mouse    81 AVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYGAINHFAGGDLLVTGSKATANIFAT 145

  Fly   137 ---------QAVLIEALITFILVFVVKAVSDPGRQD-IKGSAPLAVGLAIAAGHLCAIKLSGASM 191
                     :..|.||.:|.:|...:.|::|..... ::|:.||.:|:.:....:.....||.::
Mouse   146 YLPEYMTLWRGFLDEAFVTGMLQLCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMNSGYAI 210

  Fly   192 NPARSFGP 199
            ||:|...|
Mouse   211 NPSRDLPP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 53/200 (27%)
Aqp7NP_001365567.1 MIP 18..232 CDD:412216 53/201 (26%)
NPA 1 79..81 1/1 (100%)
NPA 2 211..213 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.