DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp5

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_033831.1 Gene:Aqp5 / 11830 MGIID:106215 Length:265 Species:Mus musculus


Alignment Length:211 Identity:91/211 - (43%)
Similarity:132/211 - (62%) Gaps:6/211 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WRMLLGELVGTFFLIFVGVGSTTS--GSVP---QIAFTFGLTVATIAQGLGHLSGCHINPAVTLG 82
            ::.:..|.:.|...:|.|:||...  .::|   ||:..|||.:.|:||.||.:||.|||||:||.
Mouse    11 FKAVFAEFLATLIFVFFGLGSALKWPSALPTILQISIAFGLAIGTLAQALGPVSGGHINPAITLA 75

  Fly    83 FLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITF 147
            .||..:||:|:|.||:..|.|||||||.::.....|.|.|:|.|::...:....:||::|.::||
Mouse    76 LLIGNQISLLRAIFYVAAQLVGAIAGAGILYWLAPGNARGNLAVNALSNNTTPGKAVVVELILTF 140

  Fly   148 ILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWT-YHWV 211
            .|...:.:.:|..|....||..|::||::..|||..|..:|.|||||||||||||...:: .|||
Mouse   141 QLALCIFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPSHWV 205

  Fly   212 YWVGPIAGGLLAGIIY 227
            :|||||.|.:||.|:|
Mouse   206 FWVGPIVGAVLAAILY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 90/209 (43%)
Aqp5NP_033831.1 MIP 4..221 CDD:278651 90/209 (43%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 69..71 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 185..187 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830743
Domainoid 1 1.000 199 1.000 Domainoid score I3056
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I3747
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm43450
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.