DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp4

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001304658.1 Gene:Aqp4 / 11829 MGIID:107387 Length:352 Species:Mus musculus


Alignment Length:242 Identity:107/242 - (44%)
Similarity:147/242 - (60%) Gaps:17/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGSTTS--GS-------VPQIAFTFGLTVAT 62
            |..|.||    ..:..|:.:..|.:.|...:.:|||||.:  ||       :..|:..|||::||
Mouse    23 MVAFKGV----WTQAFWKAVSAEFLATLIFVLLGVGSTINWGGSENPLPVDMVLISLCFGLSIAT 83

  Fly    63 IAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVS 127
            :.|..||:||.|||||||:..:...:|||.|:.||||.||:|||.||.::.:.......|.|||:
Mouse    84 MVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVT 148

  Fly   128 SFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMN 192
            :...:|.....:|:|.:|||.|||.:.|..|..|.|:.||..||:|.::|.|||.||..:|||||
Mouse   149 TVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMN 213

  Fly   193 PARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIF----KLKK 235
            |||||||||:.|.|..||:||||||.|.:|||.:|..:|    :||:
Mouse   214 PARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDVELKR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 99/212 (47%)
Aqp4NP_001304658.1 MIP 31..248 CDD:278651 99/216 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 199 1.000 Domainoid score I3056
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37507
Inparanoid 1 1.050 202 1.000 Inparanoid score I3747
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm43450
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - LDO PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.