DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp3

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_057898.2 Gene:Aqp3 / 11828 MGIID:1333777 Length:292 Species:Mus musculus


Alignment Length:251 Identity:69/251 - (27%)
Similarity:102/251 - (40%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KIWRMLLGELVGTFFLIFVGVGST--------TSGSVPQIAFTFGLTVATIAQGLGHLSGCHINP 77
            ::.|..|.|.:||..|:..|.||.        |.|....|...||..|.......|.:||.|:||
Mouse    20 RLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNP 84

  Fly    78 AVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI--------------KVALDGVAGGDLGVSS 128
            |||.....:.....:|...|.:.|.:||..||.::              ::.:.| ..|..|:.:
Mouse    85 AVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLYYDAIWAFANNELFVSG-PNGTAGIFA 148

  Fly   129 FDPS--LNCAQAVLIEALITFILVFVVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKLSGAS 190
            ..||  |:.......:.:.|..|:..|.|:.||....: :|.....|||.:..........||.:
Mouse   149 TYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYA 213

  Fly   191 MNPARSFGPAVVQGV--W-------TYHWVYWVGPIAGGLLAGIIYRLIFKLKKGC 237
            :||||.|||.:...:  |       ..|| :|| ||...||..|....:::|..||
Mouse   214 VNPARDFGPRLFTALAGWGSEVFTTGRHW-WWV-PIVSPLLGSIAGVFVYQLMIGC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 66/237 (28%)
Aqp3NP_057898.2 MIP 23..264 CDD:238204 66/243 (27%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.