DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and Aqp1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_031498.1 Gene:Aqp1 / 11826 MGIID:103201 Length:269 Species:Mus musculus


Alignment Length:259 Identity:101/259 - (38%)
Similarity:146/259 - (56%) Gaps:22/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VADITENKKIWRMLLGELVGTFFLIFVGVGSTTSGSVP------------QIAFTFGLTVATIAQ 65
            :|...:.|..||.::.|.:.....:|:.:||....:.|            :::..|||::||:||
Mouse     1 MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQ 65

  Fly    66 GLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFD 130
            .:||:||.|:|||||||.|:..:||||:|..|||.||||||...|::......:....||.:...
Mouse    66 SVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLVDNSLGRNDLA 130

  Fly   131 PSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPAR 195
            ..:|..|.:.||.:.|..||..|.|.:|..|:|:.||||||:||::|.|||.||..:|..:||||
Mouse   131 HGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPAR 195

  Fly   196 SFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKLKKGCTPFQGHESLWS--------LDA 251
            |||.||:...::.||::||||..||.||.:||..|  |....:.|.....:|:        |||
Mouse   196 SFGSAVLTRNFSNHWIFWVGPFIGGALAVLIYDFI--LAPRSSDFTDRMKVWTSGQVEEYDLDA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 90/215 (42%)
Aqp1NP_031498.1 MIP 4..227 CDD:278651 91/222 (41%)
NPA 1 76..78 1/1 (100%)
NPA 2 192..194 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 199 1.000 Domainoid score I3056
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S1947
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm43450
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.