DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and LOC110438841

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_021327889.1 Gene:LOC110438841 / 110438841 -ID:- Length:396 Species:Danio rerio


Alignment Length:231 Identity:69/231 - (29%)
Similarity:109/231 - (47%) Gaps:33/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELVGTFFLIFVGV---------GSTTSGSVP------------------QIAFTFGLTVATIAQG 66
            |.:||.|.:|:.:         ||.:..|:|                  .::..||::||.....
Zfish   138 EFLGTVFFLFISLSSAILWPHAGSLSVVSIPDEPLPTLDSSLASTPDPLHVSLAFGVSVARAGVC 202

  Fly    67 LGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDP 131
            ||.:   |:||.:||..:....:|..:....:..|.:.|::..|::.|........:.|  ...|
Zfish   203 LGEV---HLNPVITLALVAGLRVSPWRGVLLVGAQLLAALSACAILLVIAPTTQSSNHG--DVAP 262

  Fly   132 SLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARS 196
            .:...||:|:...:||.||..|:|.:.| :.....:.|...||:...|||.||..:|..||||||
Zfish   263 GVYLYQALLVXTAVTFQLVLCVQAATHP-KSAFSSNPPAVTGLSDTLGHLMAIGFTGCGMNPARS 326

  Fly   197 FGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFK 232
            |||||:...:..||||||||.:|.||...::.|:.:
Zfish   327 FGPAVLTMNFHNHWVYWVGPCSGSLLTWFLHDLLLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 68/224 (30%)
LOC110438841XP_021327889.1 MIP 128..357 CDD:294134 68/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.