DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and LOC101885864

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_005174182.1 Gene:LOC101885864 / 101885864 -ID:- Length:277 Species:Danio rerio


Alignment Length:229 Identity:75/229 - (32%)
Similarity:126/229 - (55%) Gaps:10/229 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VGVADITENKKIWRMLLGELVGTFFLIFVGVGSTTSGS--------VPQIAFTFGLTVATIAQGL 67
            :.:.:...:::.|:.:|.|::|:...:...:||...|.        .|.:|  .|:....:....
Zfish     1 MAIKEELRSRQFWQGILAEVLGSLVFVSAVLGSLVPGPDGVSPGPIYPALA--AGMATVVLGYCF 63

  Fly    68 GHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPS 132
            |.:||..:|||||:..|...::.:|:|..|::.||:|.|....::.::|...:.....::.....
Zfish    64 GEISGAQVNPAVTVALLATRKVDVLRAVVYLVAQCLGGILATGLMYLSLPLKSTAQNYINKVPVE 128

  Fly   133 LNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSF 197
            :|..||:.:|.|.||:|.|.|.:|.|..|::|.....||:|||:......|.:.||||:|||||.
Zfish   129 MNAGQALGMEMLATFLLGFTVFSVEDQRRREINEPGNLAIGLAVTTAIFIAGRFSGASLNPARSL 193

  Fly   198 GPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIF 231
            |||::.|.|.:|||||:|||.|.:|||:.:..||
Zfish   194 GPAIILGYWEHHWVYWIGPILGAVLAGVSHEFIF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 73/211 (35%)
LOC101885864XP_005174182.1 MIP 6..223 CDD:412216 73/218 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.