DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and mindy4

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_002663449.3 Gene:mindy4 / 100537560 ZFINID:ZDB-GENE-110411-104 Length:683 Species:Danio rerio


Alignment Length:152 Identity:32/152 - (21%)
Similarity:47/152 - (30%) Gaps:34/152 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 DLGVSSFDPSLNCA-QAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKL 186
            ||..||.|..|..: :..|.|.           .|.|...|..:||   .:...|.||.:|:...
Zfish   159 DLSSSSRDSLLTMSKEGFLSET-----------KVLDTDSQKNRGS---RIRRGIMAGPICSSSQ 209

  Fly   187 SGASMNPARSFGPAVVQGV--------WTYHWVYWVGPIAGGLLAGIIYRLIFKLKKGCTPFQGH 243
            ......|.|....:|::.:        ||..:..............:....|..|.||.....||
Zfish   210 ESNRRRPTRKTASSVIETMEDCRQASNWTNGFNTTNTKSKPSAFLQVESSSISNLHKGNIDHDGH 274

  Fly   244 ESL-----------WSLDALRI 254
            |.:           .:||.|.:
Zfish   275 ERMTKAKQKNSAPSLNLDGLHV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 22/112 (20%)
mindy4XP_002663449.3 DUF4205 337..678 CDD:290609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.