DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and LOC100509620

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_006712950.1 Gene:LOC100509620 / 100509620 -ID:- Length:375 Species:Homo sapiens


Alignment Length:275 Identity:68/275 - (24%)
Similarity:116/275 - (42%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TEMSKFVGVADITENKKIW---------RMLLGELVGTFFLIFVGVGST-------TSGSVPQIA 53
            |..||.|..:.|.:.::||         |..|.|.:.|:.::..|:||.       |.||...:.
Human    40 TRGSKMVSWSVIAKIQEIWCEEDERKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKTYGSYLGVN 104

  Fly    54 FTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI----KV 114
            ..||..|.......|.:||.|:|.|||.....:|.:...|...:::.|.:|:...||.|    ..
Human   105 LGFGFGVTMGVHVAGRISGAHMNAAVTFTNCALGRVPWRKFPVHVLGQFLGSFLAAATIYSLFYT 169

  Fly   115 ALDGVAGGDLGV----------SSFDPS-LNCAQAVLIEALITFILVFVVKAVSD-PGRQDIKGS 167
            |:...:||:|.|          :::.|. :...:..|.|..:|.:|...:..::| .....:.|:
Human   170 AILHFSGGELMVTGPFATAGIFATYLPDHMTLWRGFLNEEWLTRMLQLCLFTITDQENNPALPGT 234

  Fly   168 APLAVGLAIAAGHLCAIKLS-----GASMNPARSFGPAVVQGV--W---------TYHWVYWVGP 216
            ..|.:.:.:.     .|::|     |.::||:|...|::...:  |         .:.||..|.|
Human   235 HALVISILVV-----IIRVSHGINTGYAINPSRDPPPSIFTFIAGWGKQVFSDGENWWWVPVVAP 294

  Fly   217 IAGGLLAGIIYRLIF 231
            :.|..|.|||| |:|
Human   295 LLGASLGGIIY-LVF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 58/251 (23%)
LOC100509620XP_006712950.1 MIP 64..313 CDD:294134 61/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.