DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and LOC100497434

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_002937066.2 Gene:LOC100497434 / 100497434 -ID:- Length:259 Species:Xenopus tropicalis


Alignment Length:263 Identity:86/263 - (32%)
Similarity:132/263 - (50%) Gaps:54/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKFV--------------GVADITEN-----KKIWRMLLGELVGTFFLIFVG-----VGSTTSG 47
            |:|:|              |:|.:.:.     :|..:..:.||:|:...||:|     |....:|
 Frog     1 MAKYVCETELQNMGSESREGLAPLEKEEPSVLEKYIQPCVAELLGSTLFIFLGCLSVLVNPHNAG 65

  Fly    48 S-VPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAV 111
            . :|  |...|.|:|::...||::||.|.||||||..:|.|.::.:....|.:.|..|.:.||.:
 Frog    66 PLLP--ALVHGFTLASVISVLGNVSGGHFNPAVTLSVVICGGLTPILLVPYWVCQLSGGMLGALL 128

  Fly   112 IKVALD--------GVA----GGDLGVSSFDPSLNCAQAVLIEALITFILVF--VVKAVSDPGRQ 162
            .|...|        |.|    .|||          .|:||.:|.:::|:|:|  |:.||.:..:.
 Frog   129 AKGLADHGSFINHTGAACMLGSGDL----------VARAVGVEIVLSFLLIFTVVMGAVGELSKT 183

  Fly   163 DIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIY 227
            .:   ||.::...:.|..|....:||:.:||||:.|||||...|.|||||||||:||.||..::|
 Frog   184 PL---APYSIAFVLTAAILSGGSISGSCLNPARALGPAVVANYWDYHWVYWVGPLAGALLVSLLY 245

  Fly   228 RLI 230
            |.|
 Frog   246 RFI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 77/223 (35%)
LOC100497434XP_002937066.2 MIP 34..245 CDD:294134 78/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.