DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp9

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_002937719.2 Gene:aqp9 / 100493943 XenbaseID:XB-GENE-481514 Length:304 Species:Xenopus tropicalis


Alignment Length:241 Identity:73/241 - (30%)
Similarity:106/241 - (43%) Gaps:42/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGELVGTFFLIFVGVG-------STTSGS--VPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLG 82
            |.|...|..||.:|.|       |.||.:  ...:.|...:|:|....  |.:||.||||||:..
 Frog    37 LSEFFATCLLIILGCGCVATSVLSNTSDAYLTNNLGFAMAVTIAVYVS--GGVSGGHINPAVSFA 99

  Fly    83 FLIVGEISILKAAFYIIVQCVGAIAG-AAVIKVALDGVAGGDLGVSSFD--------------PS 132
            ..:.|.:...|..||:..|.:||||| |||..:..|.:.....|:.:.|              |.
 Frog   100 MCLTGRLKWAKFPFYVSAQFLGAIAGSAAVFGIYYDALYNYTGGILTVDGPNATAYIFATYPKPY 164

  Fly   133 LNCAQAVLIEALITFILVFVVKAVSDPGRQDI---KGSAPLAVGLAIAAGHLCAIKLSGASMNPA 194
            |:.....:.:.:.|.:|:..|.|:.|  .:::   ||..|:||||.|....|.....||.:||||
 Frog   165 LSIMGGFVDQVMSTALLLIGVLAIFD--NKNLGTPKGLEPIAVGLLILLLGLSLGMNSGCAMNPA 227

  Fly   195 RSFGPAVVQGV--W---------TYHWVYWVGPIAGGLLAGIIYRL 229
            |..||.:...:  |         ::.||..|||:.|..:...||.|
 Frog   228 RDLGPRIFTAMAGWGMEVFTSGNSWWWVPVVGPMLGAAIGAFIYVL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 70/237 (30%)
aqp9XP_002937719.2 MIP 30..275 CDD:412216 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.