DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and LOC100491830

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_012813770.2 Gene:LOC100491830 / 100491830 -ID:- Length:276 Species:Xenopus tropicalis


Alignment Length:212 Identity:91/212 - (42%)
Similarity:127/212 - (59%) Gaps:5/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGSTTS--GSVP---QIAFTFGLTVATIAQGLGHLSGCHINPAVTLGF 83
            |.|..|.:||.|.:.:|:.||.|  .::|   ||:.||||.:||:.|.:||:|..|:|||||:.|
 Frog    18 RSLFAEFLGTLFFVLLGLSSTLSWPKALPAALQISLTFGLAIATMVQTMGHISKAHLNPAVTVAF 82

  Fly    84 LIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFI 148
            |:...|||.||..||.||.:||:.||.::.........|:.||:......:..|...:|.|.|..
 Frog    83 LLAAHISISKAVLYITVQVLGAVVGAGLLYKFTPSNLHGNFGVNLLSNGTSPGQGFAVEVLTTMQ 147

  Fly   149 LVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYW 213
            ||..:.|.:|..|.|..||..:::||::..||...|..:|.||||||||.||::.|.:|.|||.|
 Frog   148 LVLCIFATTDSHRMDNIGSPSISIGLSVTLGHFLGIYFTGCSMNPARSFAPALITGNFTDHWVVW 212

  Fly   214 VGPIAGGLLAGIIYRLI 230
            |||:|||:.|.:||..|
 Frog   213 VGPMAGGIFASLIYNFI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 88/207 (43%)
LOC100491830XP_012813770.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.