DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and LOC100489792

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_002935778.1 Gene:LOC100489792 / 100489792 -ID:- Length:267 Species:Xenopus tropicalis


Alignment Length:237 Identity:91/237 - (38%)
Similarity:135/237 - (56%) Gaps:10/237 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGSTTS-----GSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGF 83
            |..:.|.:||...:|.|:.|...     .||.||:.||||.|.||.|.:||:||.|:|||||:.|
 Frog    11 RAFVAEFLGTLVFVFFGLCSAMQWAPELPSVLQISLTFGLGVGTIVQAVGHISGAHLNPAVTIAF 75

  Fly    84 LIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFI 148
            |:..:||:.:|..||..|.:||:.|||::.........|:.||:....:....|||.:|.::|..
 Frog    76 LVASQISLFRALCYICAQLLGAVVGAALLHEFTPESVHGNFGVNLLSNNTTEGQAVTVEMILTLQ 140

  Fly   149 LVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYW 213
            |:..|.|.:|..|.|..||..:::||::|.|||..|..:|.|||||||||||::.|.:..||::|
 Frog   141 LILCVFASTDSNRCDNVGSPSISIGLSVAVGHLVGIYFTGCSMNPARSFGPALIAGNFDAHWIFW 205

  Fly   214 VGPIAGGLLAGIIYRLIFKLKKGCTPFQGHESLWSLDALRIP 255
            :||..|.::|.::|..:.     |...|......|:...|:|
 Frog   206 IGPFTGAIIASLLYNYVL-----CPQQQSFSEKLSILLGRMP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 85/207 (41%)
LOC100489792XP_002935778.1 MIP 3..219 CDD:333943 85/207 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm48599
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.