DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp4

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001304775.1 Gene:aqp4 / 100487371 XenbaseID:XB-GENE-487854 Length:345 Species:Xenopus tropicalis


Alignment Length:244 Identity:103/244 - (42%)
Similarity:148/244 - (60%) Gaps:21/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKIWRMLLGELVGTFFLIFVGVGSTTSGSV---PQ------IAFTFGLTVATIAQGLGHLSGCHI 75
            ::.|:.:.||.:.....:.:.:|||.:.|.   ||      ||..|||::||:.|..||:||.||
 Frog    32 QEFWKAVTGEFLAMLIFVLLSLGSTINWSPKDNPQPADLVLIALCFGLSIATLVQCFGHISGGHI 96

  Fly    76 NPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVL 140
            |||||:..:.:.:||:.|:.|||:.||:||||||.::.:.......|:||.:..:..|:.|..:|
 Frog    97 NPAVTVAMVSMRKISLAKSIFYIVAQCLGAIAGAGILYLVTPSDVAGNLGATMVNTKLSSAHGLL 161

  Fly   141 IEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGV 205
            :|.:|||.|||.:.|..||.|:||.||..||:|.::|.|||.||..:||||||||||||||:...
 Frog   162 VELIITFQLVFTICASCDPKRKDISGSVALAIGFSVAIGHLFAIPYTGASMNPARSFGPAVIMNK 226

  Fly   206 WTYHWVYWVGPIAGGLLAGIIYRLIF------------KLKKGCTPFQG 242
            |..||||||||:.|.::||.:|..::            .|.|...|.:|
 Frog   227 WESHWVYWVGPVLGAVIAGALYEYVYCPDPELKNHLKEVLNKATQPSKG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 98/212 (46%)
aqp4NP_001304775.1 MIP 31..248 CDD:278651 98/215 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 205 1.000 Domainoid score I2848
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37507
Inparanoid 1 1.050 207 1.000 Inparanoid score I3605
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm48599
Panther 1 1.100 - - LDO PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.