DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and XB5993457

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001135583.1 Gene:XB5993457 / 100216133 XenbaseID:XB-GENE-5993458 Length:268 Species:Xenopus tropicalis


Alignment Length:233 Identity:92/233 - (39%)
Similarity:136/233 - (58%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGSTTSGSVP-----QIAFTFGLTVATIAQG 66
            |:.|.|:    ..::.|..:.||.:..|..:.|.:|||...::|     .||..||.::|.:...
 Frog     1 MTAFKGI----WTRQFWTSMAGEFLAVFLFLVVSLGSTAGITIPGPSETHIALCFGFSIAILIHC 61

  Fly    67 LGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGD---LGVSS 128
            .||:...::||||.:..:...:||..|..||||:||:.|||||.|:.:    :...|   :|::.
 Frog    62 FGHICEAYLNPAVAMAMICTKKISAAKGIFYIIIQCLAAIAGAGVVAL----ITPNDKWPVGITK 122

  Fly   129 FDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNP 193
            ...:::..||:|:|.||||.|||.:.|..|..|.|||...||.:||::..|||.|||.:||||||
 Frog   123 EHETISHGQALLVETLITFQLVFTIFASCDKKRSDIKVPIPLIIGLSVTIGHLFAIKYTGASMNP 187

  Fly   194 ARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIF 231
            |||.|.:||...|..||:||:||:.||:||..:|..:|
 Frog   188 ARSLGTSVVFNHWENHWIYWIGPMMGGILASFVYEYLF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 87/211 (41%)
XB5993457NP_001135583.1 MIP 12..221 CDD:350945 87/212 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 205 1.000 Domainoid score I2848
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 207 1.000 Inparanoid score I3605
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm48599
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.