DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and mip

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001090816.1 Gene:mip / 100037914 XenbaseID:XB-GENE-484627 Length:264 Species:Xenopus tropicalis


Alignment Length:233 Identity:95/233 - (40%)
Similarity:130/233 - (55%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WRMLLGELVGTFFLIFVGVGSTTS-----GSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLG 82
            ||.:..|...|.|.:|.|:|::..     .:|..||..||..:||:.|.:||:||.|||||||..
 Frog    11 WRAIFAEFFATMFYVFFGLGASLKWAAGPANVLNIALAFGFALATLVQSVGHISGAHINPAVTFA 75

  Fly    83 FLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITF 147
            |||..::|..:|.|||..|.:||:|||||:.........|:|.:::..|.::..||..:||.:|.
 Frog    76 FLIGSQMSFFRAIFYIAAQLLGAVAGAAVLYGVTPTAVRGNLALNTIHPGVSLGQATTVEAFLTL 140

  Fly   148 ILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVY 212
            ..|..:.|..|..|....||..||:|.::|.|||..|..:||||||||||.|||:...:..||||
 Frog   141 QFVLCIFATFDERRNGRMGSVSLALGFSVALGHLFGIYYTGASMNPARSFAPAVLTRNFVNHWVY 205

  Fly   213 WVGPIAGGLLAGIIYRLI-----------FKLKKGCTP 239
            |||||.||.:.|::|..|           ..:.||..|
 Frog   206 WVGPIIGGAVGGLVYDFILFPRMRGLNERLSILKGARP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 90/208 (43%)
mipNP_001090816.1 MIP 4..220 CDD:333943 90/208 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 205 1.000 Domainoid score I2848
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm48599
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.