DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and aqp10b

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_005159449.1 Gene:aqp10b / 100034395 ZFINID:ZDB-GENE-060503-57 Length:309 Species:Danio rerio


Alignment Length:253 Identity:73/253 - (28%)
Similarity:112/253 - (44%) Gaps:57/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMLLGELVGTFFLIFVGVGS----TTSGSVP------QIAFTFGLTVAT-IAQGLGHLSGCHINP 77
            |..|.|..|.:.||..|.||    |||.:..      .:.|..|.|... ||:|   :||.|:||
Zfish    16 RECLAEFFGVYVLILFGCGSVAQVTTSQNTKGEYLSINLGFALGTTFGIYIAKG---VSGAHLNP 77

  Fly    78 AVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKV----ALDGVAGGDL---------GVSSF 129
            ||::...::|..|..:..||:..|..||...||.:.:    |:....||.|         |:.|.
Zfish    78 AVSVSLCVLGRFSWTRLPFYVCSQLFGAFLAAATVALQYYDAIMDFTGGHLTVSGATATAGIFST 142

  Fly   130 DPS--LNCAQAVLIEALITFILVFVVKAVSD----PGRQDIK----GSAPLAVGLAIAAGHLCAI 184
            .|:  |:....|:.:.:.|..|:..|.|:.|    |....::    |:|.|.:|:::.:.     
Zfish   143 YPADYLSLWGGVVDQIIGTAALLVCVLALGDAHNTPAPAGLEPVLVGAAVLVIGISMGSN----- 202

  Fly   185 KLSGASMNPARSFGPAVVQGV--W------TYHWVYWVGPI----AGGLLAGIIYRLI 230
              ||.::||||.|||.:...:  |      ..|..:|| ||    .|.||..::|.|:
Zfish   203 --SGYAINPARDFGPRLFSYIAGWGDEVFRAGHGWWWV-PIIVTCVGALLGSLLYELL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 71/248 (29%)
aqp10bXP_005159449.1 MIP 5..247 CDD:294134 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.