DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7763 and MRC2

DIOPT Version :9

Sequence 1:	NP_001356891.1	Gene:	CG7763 / 36235	FlyBaseID:	FBgn0040503	Length:	232	Species:	Drosophila melanogaster
Sequence 2:	NP_006030.2	Gene:	MRC2 / 9902	HGNCID:	16875	Length:	1479	Species:	Homo sapiens

Alignment Length:	129	Identity:	39/129 - (30%)
Similarity:	58/129 - (44%)	Gaps:	15/129 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   109 FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNR-----YWIDVT 168
            ||:...|::    |....|..|...|......|.|:.||.|||..::.|...:|     :||.:.
Human   832 FQEAEYKFF----EHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLH 892

  Fly   169 NQFNESEFVSVTKGSKANFLSWADGEPT---KDGECVDIRTFNGKTTMNDNSCFANLYFICEKS 229
            ...::..| ..|.||..||:|||.|:|.   ||.:||.:..  .:....|..|...|.:||::|
Human   893 TSESDGRF-RWTDGSIINFISWAPGKPRPVGKDKKCVYMTA--SREDWGDQRCLTALPYICKRS 953

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7763	NP_001356891.1	CLECT	116..228	CDD:153057	35/119 (29%)
MRC2	NP_006030.2	RICIN	43..>127	CDD:238092
		RICIN	46..161	CDD:214672
		FN2	180..228	CDD:128373
		CLECT	247..361	CDD:153057
		CLECT	382..505	CDD:214480
		CLECT	521..644	CDD:214480
		CLECT	669..809	CDD:214480
		CLECT	829..951	CDD:214480	37/125 (30%)
		CLECT	972..1108	CDD:214480
		CLECT	1137..1245	CDD:153057
		CLECT	1261..1394	CDD:214480
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1450..1479
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910