DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CLEC6A

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001007034.1 Gene:CLEC6A / 93978 HGNCID:14556 Length:209 Species:Homo sapiens


Alignment Length:125 Identity:38/125 - (30%)
Similarity:57/125 - (45%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTN-QFN 172
            ::..||..|:|..|||: |..:...|.:||.||....::.|.:....|||....|::.::: |.|
Human    83 WKSFGSSCYFISSEEKV-WSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGN 146

  Fly   173 ES-EFVSVTKGSKANFLSWADGEPTKDGE-CVDIRTFNGKTT---MNDNSCFANLYFICE 227
            .: :::..|...| |...|..|||....| |..|..:  |.|   .||..|......|||
Human   147 NNWQWIDKTPYEK-NVRFWHLGEPNHSAEQCASIVFW--KPTGWGWNDVICETRRNSICE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 36/118 (31%)
CLEC6ANP_001007034.1 CLECT_DC-SIGN_like 79..204 CDD:153060 38/125 (30%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000269|PubMed:28652405, ECO:0007744|PDB:5VYB 168..170 1/1 (100%)