DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Sfp24F

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster


Alignment Length:132 Identity:40/132 - (30%)
Similarity:64/132 - (48%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQL---NGLNRYWIDV 167
            |:.|.::|:.||.||::.:.||..|.:.|.:....|.||::.:||...:..|   |...|||...
  Fly    35 NDTFVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNIFERYWTSG 99

  Fly   168 TNQFNESEFVSVTKGSKANFLSWADGEP-TKDGE--CVDIRTFNGKTT---MNDNSCFANLYFIC 226
            |:...:.:.|..:.|...:...|..||| .|:.|  |.::.:....|.   |||.:|.....|||
  Fly   100 TDLGTKGKHVWFSNGQPLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFIC 164

  Fly   227 EK 228
            |:
  Fly   165 EE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 36/120 (30%)
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 35/119 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.