DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and colec10

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001276917.1 Gene:colec10 / 794040 ZFINID:ZDB-GENE-131127-525 Length:271 Species:Danio rerio


Alignment Length:119 Identity:31/119 - (26%)
Similarity:52/119 - (43%) Gaps:16/119 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 YYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNG------LNRYWIDVTNQFNESE 175
            :|:...|...:..:|..|...||.||..:::|:    ||.|..      ||..:|.:.....|..
Zfish   148 FYLLVTEARTYQQSLLNCKLRGGTLAMSRTEEK----NNLLANFIKEADLNHVFIRLQAGVTEVG 208

  Fly   176 FVSVTKGSKANFLSWA-DGEPTKDGECVDIRTFNGKT-TMNDNSCFANLYFICE 227
            ::.:......|..:|| .|..:..|:||.:    |:| .::...|.|..|:|||
Zfish   209 YMYLNGNPLLNTTAWAIQGADSGKGDCVQL----GRTGALSQVDCGATQYYICE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/119 (26%)
colec10NP_001276917.1 Collagen 54..106 CDD:189968
CLECT 148..259 CDD:295302 31/119 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.