DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and si:ch211-225k7.2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_003198916.1 Gene:si:ch211-225k7.2 / 793018 ZFINID:ZDB-GENE-060503-782 Length:361 Species:Danio rerio


Alignment Length:112 Identity:27/112 - (24%)
Similarity:47/112 - (41%) Gaps:13/112 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSV 179
            :|::|  .||..|.:|...|.:....||::.:..:.......:..: |.||.:..::..|     
Zfish    24 QYHFI--NEKKTWTEAQRYCREKYTDLATVDNMNDTTELMKSVYDV-RLWIGLQRKWQWS----- 80

  Fly   180 TKGSKANFLSWADGEPTKDGECVDIRTFNGKTTMNDNSCFANLYFIC 226
             .|..|.||:|...:|....||..::  ||  ..:|..|.....|:|
Zfish    81 -SGGPALFLNWGYNQPDGSDECAFMK--NG--VWHDGKCSDTWIFVC 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/111 (24%)
si:ch211-225k7.2XP_003198916.1 CLECT 23..124 CDD:295302 27/112 (24%)
CLECT_1 127..239 CDD:153072
CLECT 245..359 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.