DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec4g

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:217 Identity:48/217 - (22%)
Similarity:79/217 - (36%) Gaps:40/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQL---LTHGTAMGRKLEEN 106
            ::.:|:..:.||....::.:..| ...|..|.......:|.::..::|   :|...|...:..||
Mouse    80 TLSSLKDDIGACRNCCSVTKAQL-QTTLAEFKDIQAKLMEQESILKELQERVTQDLAKASRDREN 143

  Fly   107 ---EIFQQL---------------------GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQ 147
               |:||.|                     ||.||:  .|.:..|..|...|...|.||..::..
Mouse   144 IRSELFQALEAVKRQNSSCEQCPPSWLPFQGSCYYF--SETQATWDTAQSYCGGQGAHLVIVRGL 206

  Fly   148 EELDRFNNQLNGLNRYWIDV--TNQFNESEFVSVTKGSKANFLSWADGEPTKD---GECVDIRTF 207
            .|....:....| ..||:.:  ....|:.:......|:..||..|..|||...   .:|: :...
Mouse   207 NEQGFLSQHTRG-RGYWLGLRAVRHLNKIQGYRWVDGASLNFSHWNSGEPNDSRGHEDCI-MMLH 269

  Fly   208 NGKTTMNDNSCFANL-YFICEK 228
            :|  ..||..|.... .:||||
Mouse   270 SG--LWNDAPCTNERDGWICEK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/117 (24%)
Clec4gNP_083741.1 COG6 61..>163 CDD:303003 16/83 (19%)
CLECT 165..289 CDD:295302 30/129 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.