DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec4a3

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001191170.1 Gene:Clec4a3 / 73149 MGIID:1920399 Length:237 Species:Mus musculus


Alignment Length:147 Identity:38/147 - (25%)
Similarity:60/147 - (40%) Gaps:32/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SQQLLTHGTAMGRKLEENEIFQQL-----------------------------GSKYYYIEKEEK 124
            |..|:|..|...:.|||..|.::|                             ||..|:...:..
Mouse    62 SGALITLFTKYSQLLEEKMIIKELNYTELECTKWASLLEDKVWSCCPKDWKPFGSYCYFTSTDLV 126

  Fly   125 LNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNES-EFVSVTKGSKANFL 188
            .:|:::.:.|..||.||..:.||||.|.....|:....|:|.::|..::. :::..|.... |..
Mouse   127 ASWNESKENCFHMGAHLVVIHSQEEQDFITGILDTGTAYFIGLSNPGDQQWQWIDQTPYDD-NTT 190

  Fly   189 SWADGEPTKDGE-CVDI 204
            .|..|||:.|.| ||.|
Mouse   191 FWHKGEPSSDNEQCVII 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/91 (30%)
Clec4a3NP_001191170.1 DUF2418 41..>82 CDD:287321 7/19 (37%)
CLECT_DC-SIGN_like 107..230 CDD:153060 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.