DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Colec11

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:159 Identity:44/159 - (27%)
Similarity:68/159 - (42%) Gaps:24/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QLENQNTSQQLLTHGTAMGRKLEENEI--------FQQLGSKYYYIEKEEKLNWHDALDKCHKMG 138
            :::||.|  ||.|.     .|..:|.:        .::..||.|.:.|||| .:.||...|...|
Mouse   125 EMDNQVT--QLTTE-----LKFIKNALPSPAAVAGVRETESKIYLLVKEEK-RYADAQLSCQARG 181

  Fly   139 GHLASLQSQEELDRFNNQL--NGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTK---D 198
            |.|:..:.:.......:.|  .||.|.:|.:.:...|..||...:.....|..|..|||..   :
Mouse   182 GTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDE 246

  Fly   199 GECVDIRTFNGKTTMNDNSCFANLYFICE 227
            .:||::....|   .||.:|...:||:||
Mouse   247 EDCVEMVASGG---WNDVACHITMYFMCE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 34/117 (29%)
Colec11NP_001300907.1 Collagen 41..96 CDD:189968
CLECT_collectin_like 158..273 CDD:153061 36/119 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.