DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CLEC3B

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_016862606.1 Gene:CLEC3B / 7123 HGNCID:11891 Length:209 Species:Homo sapiens


Alignment Length:133 Identity:30/133 - (22%)
Similarity:55/133 - (41%) Gaps:20/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GSKYY---YIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDR----FNNQLNGLNRYWIDVTNQ 170
            |:|.:   ::...:...:|:|.:.|...||.|.:.|:..|.|.    ....:......|:.:.:.
Human    81 GTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDM 145

  Fly   171 FNESEFVSVTKGSKANFLSW-------ADGEPTKDGECVDIR-TFNGKTTMNDNSCFANLYFICE 227
            ..|..:|.:| |::..:.:|       .||..|::  |..:. ..|||  ..|..|...|.:||:
Human   146 AAEGTWVDMT-GARIAYKNWETEITAQPDGGKTEN--CAVLSGAANGK--WFDKRCRDQLPYICQ 205

  Fly   228 KSI 230
            ..|
Human   206 FGI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/126 (21%)
CLEC3BXP_016862606.1 CLECT_tetranectin_like 78..206 CDD:153066 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.