DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec4b1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001177239.1 Gene:Clec4b1 / 69810 MGIID:1917060 Length:209 Species:Mus musculus


Alignment Length:221 Identity:52/221 - (23%)
Similarity:79/221 - (35%) Gaps:68/221 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LNDRRLDNFGTSTNLQLENQNTSQQLL-----------THGTAM---GRKLEENEIFQQL----- 112
            :.:|:|.....|.:|:|.:......||           |:..:|   .|:|.|.:.:..|     
Mouse     2 VQERQLQGKAVSWSLRLWSAAVISILLLSTCFIASCVVTYQFSMDKPNRRLSELDRYHSLTCFSE 66

  Fly   113 -------------------GSKYYYIEKE-EKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQL 157
                               ||..|.:... ...:|:.:.:.|.:||.||..:.||||.|.....|
Mouse    67 GNMVSDKVWSCCPKDWKLFGSHCYLVPTVFSSASWNKSEENCSRMGAHLVVIHSQEEQDFITGIL 131

  Fly   158 NGLNRY-------------WIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDGE-CVDI-RTF 207
            :....|             |:|.| .:.|    |||        .|.:|||:.|.| ||.: ...
Mouse   132 DIHAAYFIGLWDTGHRQWQWVDQT-PYEE----SVT--------FWHNGEPSSDNEKCVTVYYRR 183

  Fly   208 NGKTTMNDNSCFANLYFICE-KSIEI 232
            |.....||.||......:|: |.|.:
Mouse   184 NIGWGWNDISCNLKQKSVCQMKKINL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 35/128 (27%)
Clec4b1NP_001177239.1 CLECT_DC-SIGN_like 78..204 CDD:153060 37/138 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.