DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Cd209b

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_081248.4 Gene:Cd209b / 69165 MGIID:1916415 Length:325 Species:Mus musculus


Alignment Length:219 Identity:46/219 - (21%)
Similarity:88/219 - (40%) Gaps:48/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QRRVEACEAAVAIARIALNDRRLDNF----GTSTNLQLENQNTSQQLLTHGTAMGRKL------- 103
            |.:.|:.:|.:....:.|....|...    |.:.::|   :..|:||:.....:..|:       
Mouse   109 QGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQ---EKISEQLMQLKAELLSKISSFPVKD 170

  Fly   104 --EENEIFQQ----------------------LGSKYYYIEKEEKLNWHDALDKCHKMGGHLASL 144
              ::.:|:||                      ||:.|::.:.:.  ||:||:..|.::...|..:
Mouse   171 DSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQR--NWNDAVTACKEVKAQLVII 233

  Fly   145 QSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLS--WADGEPTKDGE--CVDIR 205
            .|.||..............|:.:::...|:.::.|...:.::...  |..|||...||  ||:  
Mouse   234 NSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVE-- 296

  Fly   206 TFNGKTTMNDNSCFANLYFICEKS 229
             |.| ...||:.|....::||:||
Mouse   297 -FAG-DGWNDSKCELKKFWICKKS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/115 (24%)
Cd209bNP_081248.4 CLECT_DC-SIGN_like 195..317 CDD:153060 30/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.