DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC690020

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_001072955.4 Gene:LOC690020 / 690020 RGDID:1585190 Length:320 Species:Rattus norvegicus


Alignment Length:198 Identity:45/198 - (22%)
Similarity:77/198 - (38%) Gaps:48/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIFQ 110
            :||   :...|:|..::         ||:.....|..|...|.....|.|   .||::  |....
  Rat   149 LGN---KSSECDAYKSV---------LDSLNRQQNTCLRLTNIVLDCLQH---KGRQV--NVHLF 196

  Fly   111 QLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVT--NQFNE 173
            ..|.|.||...::| .|.:....|......|.::..::||.....|:.. :.|||.::  |:.::
  Rat   197 CCGIKCYYFIMDKK-QWKECEQACQGCKLSLLTIDDEDELKFLQLQVTP-DSYWIGLSYDNKKHD 259

  Fly   174 SEFVSVTKGSKANFLSWADGEPTKDGECVDIR---------TFNGKTTMNDNSCFANLY-FICEK 228
            |              :|.|..|:|  ..::|:         .|..||.:. ||...::| .||||
  Rat   260 S--------------AWIDNNPSK--FALNIKKYYVKDENFVFLSKTRLG-NSKRESVYPCICEK 307

  Fly   229 SIE 231
            .::
  Rat   308 RLD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/123 (22%)
LOC690020XP_001072955.4 Ly49 86..205 CDD:285577 17/72 (24%)
CLECT_NK_receptors_like 194..307 CDD:153063 29/131 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.