DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec4g

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038945826.1 Gene:Clec4g / 689004 RGDID:1597482 Length:293 Species:Rattus norvegicus


Alignment Length:216 Identity:49/216 - (22%)
Similarity:78/216 - (36%) Gaps:40/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTS--QQLLTHGTAMGRKLEEN-- 106
            :.:|:..|.||....::.:..|.....:...|...:..:..|..  |:.:|...|...:..||  
  Rat    81 LSSLKDDVGACRNCCSVMKAQLQTTLAEFKDTQAKVMEQESNLKDLQERVTQDLAKASRDRENIR 145

  Fly   107 -EIFQQL---------------------GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEE 149
             |:|:.|                     ||.||:  .|.:..|..|...|...|.||..::...|
  Rat   146 SELFRALETVKRQNSSCEQCPPSWLPFQGSCYYF--SETQAIWDTAQSYCVGQGAHLVIVRDLNE 208

  Fly   150 LDRFNNQLNGLNRYWIDV--TNQFNESEFVSVTKGSKANFLSWADGEPTKD---GECVDIRTFNG 209
            ....:....| ..||:.:  ..:.|:.:......|:...|..|..|||...   .:|| :...:|
  Rat   209 QGFLSQHTRG-RGYWLGLRADRRLNKIQGYRWVDGAPLTFSHWNSGEPNDSRGHEDCV-MMLHSG 271

  Fly   210 KTTMNDNSCFANLY--FICEK 228
              ..||..| ||..  :||||
  Rat   272 --LWNDAPC-ANERDGWICEK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/118 (25%)
Clec4gXP_038945826.1 CwlO1 43..>154 CDD:226400 15/72 (21%)
CLECT_DC-SIGN_like 165..289 CDD:153060 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.