DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Cd209c

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_006248854.1 Gene:Cd209c / 688951 RGDID:1582956 Length:240 Species:Rattus norvegicus


Alignment Length:135 Identity:38/135 - (28%)
Similarity:61/135 - (45%) Gaps:32/135 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEE---LDRFNNQ-------LNGLNR- 162
            ||  |:.|::.:.::  ||.|::..|.|:|..|..::|.:|   |.:.:.:       |:.|.| 
  Rat   117 FQ--GNCYFFSKFQQ--NWKDSVTSCRKLGAQLVVVKSDDEQSFLQQTSKEKGYAWMVLSDLKRE 177

  Fly   163 ---YWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDGECVDIRTFNGKTTMNDNSCFANLYF 224
               :|:|.::.     ..|.||       .|..|||..:.| .|...|.| ...||..|....|:
  Rat   178 GIWHWVDGSHL-----LFSFTK-------YWNKGEPNNEWE-EDCAEFRG-DGWNDAPCTNKKYW 228

  Fly   225 ICEKS 229
            ||:||
  Rat   229 ICKKS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/125 (26%)
Cd209cXP_006248854.1 CLECT_DC-SIGN_like 110..232 CDD:153060 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.