DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Cd209f

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_001068161.4 Gene:Cd209f / 688750 RGDID:1585258 Length:277 Species:Rattus norvegicus


Alignment Length:195 Identity:51/195 - (26%)
Similarity:84/195 - (43%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VAIARIALN-------DRRLDNFG--------TSTNLQLENQNTSQQLLTHGTAMGRKLE----E 105
            |.|:||..|       .:...:||        |.|.|: :.|...|||.....::.....    :
  Rat    83 VQISRICANPQGQTQDQKGSSSFGKVAVPQEQTYTGLE-QIQQIQQQLTQFNASLAGLCRPCPWD 146

  Fly   106 NEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLA---SLQSQEELDRFNNQLNGLNRYWIDV 167
            .|.||  ||.|.:  .....:|..:...|..:|.||.   |:..|:.|..::.:.:.|.  ||.:
  Rat   147 WEFFQ--GSCYLF--SRTLASWGASASSCKDLGAHLVIVNSVAEQQFLKYWHIRQSQLT--WIGL 205

  Fly   168 TNQFNES--EFVSVTKGSKANFLSWADGEPTK--DGECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            ::...|.  ::|..|. .|.:|  |.:|||..  |.:||.|    .:...||::|.||.:::||:
  Rat   206 SDHQREGSWQWVDDTP-LKLSF--WKEGEPNNAGDEDCVVI----AEDKWNDSTCSANNFWVCEQ 263

  Fly   229  228
              Rat   264  263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/118 (26%)
Cd209fXP_001068161.4 CLECT_DC-SIGN_like 143..262 CDD:153060 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.