DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and SFTPA1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001087239.2 Gene:SFTPA1 / 653509 HGNCID:10798 Length:263 Species:Homo sapiens


Alignment Length:169 Identity:42/169 - (24%)
Similarity:71/169 - (42%) Gaps:36/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GTSTNLQLENQNT-----SQQLLTHGT--------AMGRKLEENEIFQQLGSKYYYIEKEEKLNW 127
            |...:|..|.|.|     .|.|.|.|.        .:|.|     :|...|....:         
Human   113 GLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEK-----VFSSNGQSITF--------- 163

  Fly   128 HDAL-DKCHKMGGHLASLQSQEELDRFNNQLNGLNRY-WIDVTNQFNESEFVSVTKGSKANFLSW 190
             ||: :.|.:.||.:|..::.||.:...:.:...|.| ::.:|...:..:| ..:.|:..|:.:|
Human   164 -DAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDF-RYSDGTPVNYTNW 226

  Fly   191 ADGEPTKDG--ECVDIRTFNGKTTMNDNSCFANLYFICE 227
            ..|||...|  :||::.| :|:  .||.:|..:...|||
Human   227 YRGEPAGRGKEQCVEMYT-DGQ--WNDRNCLYSRLTICE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 29/116 (25%)
SFTPA1NP_001087239.2 Collagen 43..115 CDD:189968 1/1 (100%)
CLECT_collectin_like 151..263 CDD:153061 32/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.