DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec10a

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:238 Identity:45/238 - (18%)
Similarity:78/238 - (32%) Gaps:88/238 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LDNFGTSTNLQLENQNTSQQLLTHGTAM--------------GRKLEENE-IFQQLGSKYYYIEK 121
            |||..::|..:|      |.|.:.|.::              |::|:... :.|::.|....:||
  Rat    75 LDNTTSNTKAEL------QALASRGDSLQTGINSLKVEVDDHGQELQAGRGLSQKVASLESTVEK 133

  Fly   122 EE---KLNWHDALDKCHKMGGHLASLQSQ-----------------------------------E 148
            :|   :.:..:..|:..::|..|.:|..|                                   .
  Rat   134 KEQTLRTDLSEITDRVQQLGKDLKTLTCQLASLKNNGSAVACCPLHWMEHEGSCYWFSQSGKPWP 198

  Fly   149 ELDRF----NNQLNGLNRY---------------WIDVTNQFNESEFVSVTKGSKANFLSWADGE 194
            |.|::    |:.|..:|..               ||.:|:|.....:|..|...| .|..||..:
  Rat   199 EADKYCQLENSNLVAVNSLAEQNFLQTHMGSVVTWIGLTDQNGPWRWVDGTDYEK-GFTHWAPKQ 262

  Fly   195 PTK-------DGECVDIRTFNGKTTMNDNSCFANLYFICEKSI 230
            |..       .||  |...|......||:.|.....::||..:
  Rat   263 PDNWYGHGLGGGE--DCAHFTSDGRWNDDVCQRPYRWVCEMKL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 32/175 (18%)
Clec10aXP_008766090.1 Lectin_N 21..166 CDD:281887 20/96 (21%)
Apolipoprotein <63..166 CDD:279749 20/96 (21%)
CLECT_DC-SIGN_like 176..301 CDD:153060 24/127 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.