DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and SELL

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_000646.3 Gene:SELL / 6402 HGNCID:10720 Length:372 Species:Homo sapiens


Alignment Length:109 Identity:31/109 - (28%)
Similarity:47/109 - (43%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 YYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLN-GLNRYWIDVTNQFNESEFVSV 179
            |:|.||  .:||..|...|......|.::|::.|::.....|. ..:.|||.:........:|..
Human    41 YHYSEK--PMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGT 103

  Fly   180 TKGSKANFLSWADGEPT--KDGE-CVDIRTFNGKTT--MNDNSC 218
            .|.......:|.||||.  |:.| ||:|.....|..  .||::|
Human   104 NKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDAC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/109 (28%)
SELLNP_000646.3 CCP 197..255 CDD:153056
CCP 259..317 CDD:153056
CLECT_selectins_like 39..157 CDD:153062 31/109 (28%)
EGF_CA <165..192 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.