Sequence 1: | NP_001356891.1 | Gene: | CG7763 / 36235 | FlyBaseID: | FBgn0040503 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002966.1 | Gene: | CLEC11A / 6320 | HGNCID: | 10576 | Length: | 323 | Species: | Homo sapiens |
Alignment Length: | 230 | Identity: | 52/230 - (22%) |
---|---|---|---|
Similarity: | 84/230 - (36%) | Gaps: | 55/230 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 YCYGVLNPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTN-----LQLENQNTSQQLL 93
Fly 94 THGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLN 158
Fly 159 GLNRY------------WIDVTNQFNESEFVSVTKGSKANFLSW-------ADGEPTKDGECVDI 204
Fly 205 RTFNGKTTMN------------DNSCFANLYFICE 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7763 | NP_001356891.1 | CLECT | 116..228 | CDD:153057 | 29/143 (20%) |
CLEC11A | NP_002966.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 55..106 | ||
Cell attachment site. /evidence=ECO:0000255 | 61..63 | ||||
CLECT_tetranectin_like | 177..321 | CDD:153066 | 32/153 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 272..295 | 4/22 (18%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 49 | 1.000 | Domainoid score | I11773 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 55 | 1.000 | Inparanoid score | I5435 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.960 |