DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CLEC11A

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_002966.1 Gene:CLEC11A / 6320 HGNCID:10576 Length:323 Species:Homo sapiens


Alignment Length:230 Identity:52/230 - (22%)
Similarity:84/230 - (36%) Gaps:55/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YCYGVLNPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTN-----LQLENQNTSQQLL 93
            |..|.|....|.:..|..|:.|.:..|  ..:....|:|.|....|.     || |.|..:::  
Human   110 YILGRLAGLDAGLHQLHVRLHALDTRV--VELTQGLRQLRNAAGDTRDAVQALQ-EAQGRAER-- 169

  Fly    94 THGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLN 158
            .||     :||......:||.|.:.:.::.:.. ..|..:|...||.||     :..||  .|:.
Human   170 EHG-----RLEGCLKGLRLGHKCFLLSRDFEAQ-AAAQARCTARGGSLA-----QPADR--QQME 221

  Fly   159 GLNRY------------WIDVTNQFNESEFVSVTKGSKANFLSW-------ADGEPTKDGECVDI 204
            .|.||            |:.|.::..|..:: ...|.:.:|.:|       ...:|:.....:..
Human   222 ALTRYLRAALAPYNWPVWLGVHDRRAEGLYL-FENGQRVSFFAWHRSPRPELGAQPSASPHPLSP 285

  Fly   205 RTFNGKTTMN------------DNSCFANLYFICE 227
            ...||.|..|            |:.|...||::||
Human   286 DQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 29/143 (20%)
CLEC11ANP_002966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..106
Cell attachment site. /evidence=ECO:0000255 61..63
CLECT_tetranectin_like 177..321 CDD:153066 32/153 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..295 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5435
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.