DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Ncan

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_113841.2 Gene:Ncan / 58982 RGDID:619941 Length:1263 Species:Rattus norvegicus


Alignment Length:214 Identity:51/214 - (23%)
Similarity:74/214 - (34%) Gaps:62/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CEGVESDSQCAAYCYGVLNPCIASM-GNL-QRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLE 84
            |...|:...|.....|.:..|:.|. ||| ::..|.|            ||....|         
  Rat   999 CSPCENGGTCIDEVNGFICLCLPSYGGNLCEKDTEGC------------DRGWHKF--------- 1042

  Fly    85 NQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEE 149
             |....:...|..|                            |.||...|.:..|||.|:.|.||
  Rat  1043 -QGHCYRYFAHRRA----------------------------WEDAERDCRRRAGHLTSVHSPEE 1078

  Fly   150 LDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTK---DGE-C-VDIRTFNG 209
             .:|.|.. |....||.:.::..|.:| ..|..:...:.:|.:.:|..   .|| | |.:...||
  Rat  1079 -HKFINSF-GHENSWIGLNDRTVERDF-QWTDNTGLQYENWREKQPDNFFAGGEDCVVMVAHENG 1140

  Fly   210 KTTMNDNSCFANLYFICEK 228
            :  .||..|..||.::|:|
  Rat  1141 R--WNDVPCNYNLPYVCKK 1157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/116 (28%)
NcanNP_113841.2 Ig 50..160 CDD:299845
Link_domain_CSPGs_modules_1_3 159..253 CDD:239594
Link_domain_CSPGs_modules_2_4 260..355 CDD:239597
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..391
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 453..499
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..616
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 689..713
EGF 959..989 CDD:278437
EGF_CA 993..1029 CDD:238011 9/29 (31%)
CLECT 1035..1158 CDD:295302 41/178 (23%)
CCP 1162..1218 CDD:153056
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1221..1263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.