DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Acan

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038956962.1 Gene:Acan / 58968 RGDID:68358 Length:2162 Species:Rattus norvegicus


Alignment Length:123 Identity:33/123 - (26%)
Similarity:52/123 - (42%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNE 173
            ||  |..|.:....|  .|.||..:|.:...||:|:.:.||.:..|.  |..:..||.:.::..|
  Rat  1959 FQ--GHCYRHFPDRE--TWVDAERRCREQQSHLSSIVTPEEQEFVNK--NAQDYQWIGLNDRTIE 2017

  Fly   174 SEFVSVTKGSKANFLSWADGEPTK---DGECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            .:| ..:.|....|..|...:|..   .||...:..::.:...||..|...|.|.|:|
  Rat  2018 GDF-RWSDGHSLQFEKWRPNQPDNFFATGEDCVVMIWHERGEWNDVPCNYQLPFTCKK 2074

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 29/114 (25%)
AcanXP_038956962.1 Ig_Aggrecan 33..155 CDD:409481
Ig strand B 47..51 CDD:409481
Ig strand C 72..76 CDD:409481
Ig strand E 116..120 CDD:409481
Ig strand F 130..135 CDD:409481
Ig strand G 148..151 CDD:409481
Link_domain_CSPGs_modules_1_3 153..247 CDD:239594
Link_domain_CSPGs_modules_2_4 254..349 CDD:239597
Link_domain_CSPGs_modules_1_3 487..581 CDD:239594
Link_domain_CSPGs_modules_2_4 588..683 CDD:239597
PHA03307 687..>998 CDD:223039
PRK15319 <1196..>1597 CDD:185219
PLN02217 <1591..1753 CDD:215130
EGF_CA 1910..1946 CDD:238011
CLECT_CSPGs 1952..2075 CDD:153058 33/123 (27%)
CCP 2079..2135 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.