DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and clec11a

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_696773.2 Gene:clec11a / 568355 ZFINID:ZDB-GENE-130530-861 Length:273 Species:Danio rerio


Alignment Length:287 Identity:56/287 - (19%)
Similarity:104/287 - (36%) Gaps:86/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IIFLVLPLCLSSSYSAACEGVESDSQCAAYCYGVLNPCIASMGNLQRRVEACEAAV--------- 60
            |:..||..|..||    |:..::.::..|        .|.:..:|.:..|..|..|         
Zfish     6 ILAAVLGFCALSS----CDSADNTTRPPA--------TIITTADLSQAREFNEGIVRGRGDTPDI 58

  Fly    61 ------------------AIARIALNDRRLD--NFGTSTNLQLENQNTSQQLLTHGTAMGRKLEE 105
                              .::|:|..|:.:.  |.|..|   |:.:.|  |||...:.:..:|.:
Zfish    59 LEPEPTTAVSDMESTYNYILSRLAAMDQAIHRLNVGQYT---LDIKVT--QLLEKVSRLDNRLGD 118

  Fly   106 NE-IFQQLGS----------KYYYIEKEEKLNWH------------DALDKCHKMGGHLA---SL 144
            .| ..||:.|          :....:|..|:.:.            ||..||.:.||.:|   ..
Zfish   119 TEDAIQQVSSYCKDNRKEIGRLEGCQKGRKIGYKCVLAYRVYETYADASKKCQERGGRMAMPRDR 183

  Fly   145 QSQEELDRF-NNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSW----ADGEPTKDG----E 200
            :.||.|..: .:..:|....|:.:.::.:|..:: ....::..:..|    ...:|  ||    .
Zfish   184 KEQEALAEYVKSVFHGNWPVWLGINDERSEGLYL-FEDTTRVTYFQWRKHFLSSQP--DGGKREN 245

  Fly   201 CVDIRTFNGKTTMNDNSCFANLYFICE 227
            ||.:.:.:|...  |..|...:|::||
Zfish   246 CVAMSSDDGDWW--DTYCERRMYYLCE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/136 (20%)
clec11aXP_696773.2 CLECT 143..271 CDD:295302 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.