DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and si:dkey-241l7.6

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_021324413.1 Gene:si:dkey-241l7.6 / 567708 ZFINID:ZDB-GENE-041014-235 Length:156 Species:Danio rerio


Alignment Length:109 Identity:30/109 - (27%)
Similarity:54/109 - (49%) Gaps:11/109 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGL----NRYWIDVTNQFNESEFVSVTKGSKA 185
            :||..|...|..:||:|||:..::|    |:.|.||    .|.||...:...:.::: .:.||..
Zfish    49 VNWVTAERNCQSLGGNLASVHDEDE----NDFLLGLVPVSTRCWIGGHDGEQDGQWL-WSDGSVY 108

  Fly   186 NFLSWADGEPTKDGE-CVDIRTFNGKTTMNDNSCFANLYFICEK 228
            ::.:|..|||:...| |::| .:......|:..|...:.::|.|
Zfish   109 SYTNWCSGEPSSGSEHCLEI-NWTSDHCWNNQGCSTRMGYLCAK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 29/107 (27%)
si:dkey-241l7.6XP_021324413.1 CLECT 30..149 CDD:214480 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.