DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CTLMA7

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_001688318.2 Gene:CTLMA7 / 5668009 VectorBaseID:AGAP010708 Length:124 Species:Anopheles gambiae


Alignment Length:121 Identity:30/121 - (24%)
Similarity:57/121 - (47%) Gaps:15/121 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 YYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFN--------E 173
            :|:..:.|:.:..|..:|....|||||:::.||    |.|:....:...|:|:.:.        |
Mosquito     4 HYVAYKRKIKFFSAWQQCRLYNGHLASIETPEE----NAQVARAIKAVGDITDDWYIGGTDIGFE 64

  Fly   174 SEFVSVTKGSKANFLSWADGEP--TKDGECVDIRTFNGKTTMNDNSC-FANLYFIC 226
            ..||.:.....|::|::..|||  .|:.:|:.::........:|.|| :....|:|
Mosquito    65 GRFVWIGLNKIASYLNFNPGEPNNNKNEDCLIMKGSKAGEKWSDVSCEYEAEGFVC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/121 (25%)
CTLMA7XP_001688318.2 CLECT 5..120 CDD:153057 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X29
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.