DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and zgc:194252

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001122180.1 Gene:zgc:194252 / 561367 ZFINID:ZDB-GENE-081022-86 Length:251 Species:Danio rerio


Alignment Length:115 Identity:31/115 - (26%)
Similarity:55/115 - (47%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 YYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVT 180
            ::::.|  .|:|.||...|.:....|:::.|::.....:|.|...:.:||.:.|  |.::::..|
Zfish    24 HFFVNK--TLSWQDAQKYCRQNYDDLSTVGSKDLEALSSNPLIKEDYFWIGLQN--NRNQWIWST 84

  Fly   181 KGSKANFLSWADGEPT--KDGEC--VDIRTFNGKTTMNDNSCFANLYFIC 226
             |.:|....|..||||  ..|.|  |:..||..    ::..|...|:|.|
Zfish    85 -GEEARVTFWDKGEPTILLGGNCGGVNKNTFKA----SNIGCNDQLHFYC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/115 (27%)
zgc:194252NP_001122180.1 CLECT 22..131 CDD:295302 31/115 (27%)
CLECT 128..244 CDD:214480 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.