DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:201 Identity:55/201 - (27%)
Similarity:91/201 - (45%) Gaps:33/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YGVLNPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMG 100
            :..|:..|.::.|:||.:.:.|                       |||:....:..|......:.
  Fly    95 FNALSAKIKNVKNIQRHLASLE-----------------------LQLQETKKALNLSVEAKKVM 136

  Fly   101 RKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLN---- 161
            .|.|....||::|.::::|||:.|::|..|...|||||.||.::||::|||....:|..:|    
  Fly   137 PKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSH 201

  Fly   162 RYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKD--GECVDIRTFNGKTTMNDNSCFANLYF 224
            .:|:|:.:.....||:|:..|....||.|....|...  ..||.:|  .|:  |.|..|.....|
  Fly   202 DFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLR--GGE--MMDGKCSEQFLF 262

  Fly   225 ICEKSI 230
            ||:.::
  Fly   263 ICQLAV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 40/117 (34%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 36/110 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448810
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
98.900

Return to query results.
Submit another query.