DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and lectin-29Ca

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster


Alignment Length:199 Identity:51/199 - (25%)
Similarity:96/199 - (48%) Gaps:27/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YCYGVL--NPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHG 96
            :.|..|  |..:..:||:::|:|               .||.:|......:|.......:.....
  Fly    55 FTYNSLRQNGTLWRIGNMEQRLE---------------MRLQSFQNQMETKLRALKQQIEPYMEN 104

  Fly    97 TAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDR-FNNQLNGL 160
            ..|..|::.: :|:::||:::|:||::|:.|..|.|.|.:||||||::..::||:. |:.:..  
  Fly   105 VKMSNKIKMS-VFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETK-- 166

  Fly   161 NRYWIDVTNQFNE-SEFVSVTKGSKANFLSWADGEPTK-DGECVDIRTFNGKTTMNDNSCFANLY 223
            .:||:|:.::.|: :.::|...|....||.|.....|. ...||.|.:    ..|...:|..:.|
  Fly   167 KKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIHNHCVYINS----NEMYFENCANDNY 227

  Fly   224 FICE 227
            |.|:
  Fly   228 FACQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 35/115 (30%)
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448816
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
98.900

Return to query results.
Submit another query.