DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and lectin-30A

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:233 Identity:58/233 - (24%)
Similarity:100/233 - (42%) Gaps:57/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YCYGVLNPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTA 98
            ||:..:....||...|..:.   |..:.|.::|:|.::...|     :.|:.....|:::    .
  Fly     4 YCFICVILAWASRDVLANKT---ENPLLIDQVAINQQQWFTF-----IALKESEMQQKIV----R 56

  Fly    99 MGRKLEE-------------NE-------------------------IFQQLGSKYYYIEKEEKL 125
            :.|.:||             ||                         :||::|::.:|||||.|.
  Fly    57 IERSIEERLMAMQSKLAYALNELQTIMGNQSVETLEKLRISHRINPALFQRMGTRRFYIEKENKQ 121

  Fly   126 NWHDALDKCHKMGGHLASLQSQEELDR-FNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLS 189
            ||..|.:.|.::|||:|:::.::|.:. |:....|:  :|||:...|....|.|...|....|..
  Fly   122 NWFGASNTCRQLGGHIATIRDEQEFNEIFSRAPAGV--FWIDMNAMFKNGLFASSLTGRSPPFFK 184

  Fly   190 WADGEPTKDGECVDIRTFNGKTTMNDNSCFANLYFICE 227
            |...|.....:||::  :| |...|:| ||....|||:
  Fly   185 WKKEERGNKFDCVNV--YN-KEMYNEN-CFNTHLFICQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 38/113 (34%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 33/105 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448808
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
87.800

Return to query results.
Submit another query.